Lineage for d5ioif_ (5ioi F:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2542218Superfamily d.15.11: Doublecortin (DC) [89837] (1 family) (S)
    possibly related to the ubiquitin-like superfamily
  5. 2542219Family d.15.11.1: Doublecortin (DC) [89838] (3 proteins)
  6. 2542228Protein automated matches [190522] (1 species)
    not a true protein
  7. 2542229Species Human (Homo sapiens) [TaxId:9606] [187480] (5 PDB entries)
  8. 2542240Domain d5ioif_: 5ioi F: [315148]
    Other proteins in same PDB: d5ioia2, d5ioid2, d5ioie2
    automated match to d1mfwa_

Details for d5ioif_

PDB Entry: 5ioi (more details), 2.4 Å

PDB Description: x-ray structure of the n-terminal domain of human doublecortin
PDB Compounds: (F:) neuronal migration protein doublecortin

SCOPe Domain Sequences for d5ioif_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ioif_ d.15.11.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr
kigsmdeleegesyvcssdnffddveytknvnpnw

SCOPe Domain Coordinates for d5ioif_:

Click to download the PDB-style file with coordinates for d5ioif_.
(The format of our PDB-style files is described here.)

Timeline for d5ioif_: