| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.11: Doublecortin (DC) [89837] (1 family) ![]() possibly related to the ubiquitin-like superfamily |
| Family d.15.11.1: Doublecortin (DC) [89838] (3 proteins) |
| Protein automated matches [190522] (1 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187480] (5 PDB entries) |
| Domain d5ioif_: 5ioi F: [315148] Other proteins in same PDB: d5ioia2, d5ioid2, d5ioie2 automated match to d1mfwa_ |
PDB Entry: 5ioi (more details), 2.4 Å
SCOPe Domain Sequences for d5ioif_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ioif_ d.15.11.1 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr
kigsmdeleegesyvcssdnffddveytknvnpnw
Timeline for d5ioif_: