SCOPe 2.08: Domain d5hiha1: 5hih A:1-166

Lineage for d5hiha1 (5hih A:1-166)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.50: Macro domain-like [52948] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest

4. Superfamily c.50.1: Macro domain-like [52949] (4 families)

5. Family c.50.1.0: automated matches [191326] (1 protein)
   not a true family

6. Protein automated matches [190146] (12 species)
   not a true protein

7. Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [280335] (3 PDB entries)

8. Domain d5hiha1: 5hih A:1-166 [315147]
   Other proteins in same PDB: d5hiha2
   automated match to d2fava_

Details for d5hiha1

PDB Entry: 5hih, 1.66 Å

PDB Description: crystal structure of the macro domain in middle-east respiratory syndrome coronavirus

PDB Compounds: (A:) ORF1a

SCOPe Domain Sequences for d5hiha1:

Sequence; same for both SEQRES and ATOM records:

>d5hiha1 c.50.1.0 (A:1-166) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]}
dplsnfehkvitecvtivlgdaiqvakcygesvlvnaanthlkhgggiagainaaskgav
qkesdeyilakgplqvgdsvllqghslaknilhvvgpdarakqdvsllskcykamnaypl
vvtplvsagifgvkpavsfdylireaktrvlvvvnsqdvyksltiv

Timeline for d5hiha1:

• d5hiha1 first appeared in SCOPe 2.06
  
• d5hiha1 appears in SCOPe 2.07