| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.50: Macro domain-like [52948] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 6 strands, order 165243, strand 3 is antiparallel to the rest |
Superfamily c.50.1: Macro domain-like [52949] (4 families) ![]() |
| Family c.50.1.0: automated matches [191326] (1 protein) not a true family |
| Protein automated matches [190146] (12 species) not a true protein |
| Species Middle east respiratory syndrome coronavirus [TaxId:1335626] [280335] (3 PDB entries) |
| Domain d5hiha1: 5hih A:1-166 [315147] Other proteins in same PDB: d5hiha2 automated match to d2fava_ |
PDB Entry: 5hih (more details), 1.66 Å
SCOPe Domain Sequences for d5hiha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5hiha1 c.50.1.0 (A:1-166) automated matches {Middle east respiratory syndrome coronavirus [TaxId: 1335626]}
dplsnfehkvitecvtivlgdaiqvakcygesvlvnaanthlkhgggiagainaaskgav
qkesdeyilakgplqvgdsvllqghslaknilhvvgpdarakqdvsllskcykamnaypl
vvtplvsagifgvkpavsfdylireaktrvlvvvnsqdvyksltiv
Timeline for d5hiha1: