Lineage for d5i82a1 (5i82 A:2-187)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2233860Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 2233861Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 2234147Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 2234148Protein automated matches [191197] (9 species)
    not a true protein
  7. 2234191Species Corynebacterium diphtheriae [TaxId:1717] [256176] (3 PDB entries)
  8. 2234195Domain d5i82a1: 5i82 A:2-187 [315144]
    Other proteins in same PDB: d5i82a2, d5i82a3, d5i82b2, d5i82b3, d5i82c2, d5i82c3, d5i82d2, d5i82d3
    automated match to d1f0la2
    complexed with gol, so4; mutant

Details for d5i82a1

PDB Entry: 5i82 (more details), 2.35 Å

PDB Description: first crystal structure of e.coli based recombinant diphtheria toxin mutant crm197
PDB Compounds: (A:) diphtheria toxin

SCOPe Domain Sequences for d5i82a1:

Sequence, based on SEQRES records: (download)

>d5i82a1 d.166.1.0 (A:2-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
addvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpksgtqgnydddwkefystdnkyd
aagysvdnenplsgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgte
efikrfgdgasrvvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamyey
maqaca

Sequence, based on observed residues (ATOM records): (download)

>d5i82a1 d.166.1.0 (A:2-187) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
addvvdssksfvmenfssyhgtkpgyvdsiqkgiqkpkefystdnkydaagysvdnenpl
sgkaggvvkvtypgltkvlalkvdnaetikkelglslteplmeqvgteefikrfgdgasr
vvlslpfaegsssveyinnweqakalsveleinfetrgkrgqdamyeymaqaca

SCOPe Domain Coordinates for d5i82a1:

Click to download the PDB-style file with coordinates for d5i82a1.
(The format of our PDB-style files is described here.)

Timeline for d5i82a1: