![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.61.1: PRTase-like [53271] (3 families) ![]() |
![]() | Family c.61.1.1: Phosphoribosyltransferases (PRTases) [53272] (16 proteins) |
![]() | Protein automated matches [190074] (15 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:419947] [315048] (1 PDB entry) |
![]() | Domain d5iaoa_: 5iao A: [315142] automated match to d1w30a_ complexed with urf; mutant |
PDB Entry: 5iao (more details), 2.6 Å
SCOPe Domain Sequences for d5iaoa_:
Sequence, based on SEQRES records: (download)
>d5iaoa_ c.61.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} esrelmsaadvgrtisriahqiiektalddpvgpdaprvvllgiptrgvtlanrlagnit eysgihvghgalditlyrddlmikpprplastsipaggiddalvilvddvlysgrsvrsa ldalrdvgrpravqlavlvdrghrelplradyvgknvptsrsesvhvrlrehdgrdgvvi sr
>d5iaoa_ c.61.1.1 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 419947]} esrelmsaadvgrtisriahqiiektalddpvgpdaprvvllgiptrgvtlanrlagnit eysgihvghgalditlyrdstsipaggiddalvilvddvlysgrsvrsaldalrdvgrpr avqlavlvdrghrelplradyvgknvptsrsesvhvrlrehdgrdgvvisr
Timeline for d5iaoa_: