Lineage for d5igda_ (5igd A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058099Superfamily b.40.1: Staphylococcal nuclease [50199] (1 family) (S)
  5. 2058100Family b.40.1.1: Staphylococcal nuclease [50200] (2 proteins)
    barrel, closed; n=5, S=10
  6. 2058101Protein Staphylococcal nuclease [50201] (1 species)
  7. 2058102Species Staphylococcus aureus [TaxId:1280] [50202] (258 PDB entries)
    Uniprot P00644 89-223
  8. 2058324Domain d5igda_: 5igd A: [315138]
    automated match to d2lkva_
    complexed with ca, thp

Details for d5igda_

PDB Entry: 5igd (more details), 1.8 Å

PDB Description: crystal structure of staphylococcal nuclease variant delta+phs t62h/i92e at cryogenic temperature
PDB Compounds: (A:) Thermonuclease

SCOPe Domain Sequences for d5igda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5igda_ b.40.1.1 (A:) Staphylococcal nuclease {Staphylococcus aureus [TaxId: 1280]}
lhkepatlikaidgdtvklmykgqpmtfrlllvdtpefnekygpeasafhkkmvenakki
evefdkgqrtdkygrglayeyadgkmvnealvrqglakvayvykgnntheqllrkaeaqa
kkeklniws

SCOPe Domain Coordinates for d5igda_:

Click to download the PDB-style file with coordinates for d5igda_.
(The format of our PDB-style files is described here.)

Timeline for d5igda_: