Class b: All beta proteins [48724] (180 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
Protein automated matches [190740] (31 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
Domain d5if0b1: 5if0 B:1-107 [315136] Other proteins in same PDB: d5if0b2, d5if0l2 automated match to d1n0xl1 complexed with nag, po4 |
PDB Entry: 5if0 (more details), 2.44 Å
SCOPe Domain Sequences for d5if0b1:
Sequence, based on SEQRES records: (download)
>d5if0b1 b.1.1.0 (B:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr esgvpdrfsgsgsgtdftltisslqaedvavyycqqyysfgggtkveik
>d5if0b1 b.1.1.0 (B:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]} divmtqspdslavslgeratinckssqknylawyqqkpgqppklliywastresgvpdrf sgsgsgtdftltisslqaedvavyycqqyysfgggtkveik
Timeline for d5if0b1: