| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily) multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer |
Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families) ![]() basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat |
| Family a.204.1.2: MazG-like [116993] (4 proteins) Pfam PF03819 |
| Protein automated matches [315024] (2 species) not a true protein |
| Species Bacillus cereus [TaxId:1396] [315025] (1 PDB entry) |
| Domain d5ie9d_: 5ie9 D: [315122] automated match to d2gtab1 complexed with mn |
PDB Entry: 5ie9 (more details), 2.8 Å
SCOPe Domain Sequences for d5ie9d_:
Sequence, based on SEQRES records: (download)
>d5ie9d_ a.204.1.2 (D:) automated matches {Bacillus cereus [TaxId: 1396]}
meaktmkdmqkevdayigqfkegyfsplammarlteemgelarevnhyygekpkktteke
rsieeelgdvlfvmicmanslnidletahnivmnkfntrdkdr
>d5ie9d_ a.204.1.2 (D:) automated matches {Bacillus cereus [TaxId: 1396]}
meaktmkdmqkevdayigqfkegyfsplammarlteemgelarevnhyygsieeelgdvl
fvmicmanslnidletahnivmnkfntrdkdr
Timeline for d5ie9d_: