Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily) duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets |
Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) |
Family d.157.1.0: automated matches [191360] (1 protein) not a true family |
Protein automated matches [190418] (18 species) not a true protein |
Species Uncultured bacterium [TaxId:77133] [315090] (1 PDB entry) |
Domain d5iqka_: 5iqk A: [315119] automated match to d4awza_ complexed with zn |
PDB Entry: 5iqk (more details), 1.75 Å
SCOPe Domain Sequences for d5iqka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5iqka_ d.157.1.0 (A:) automated matches {Uncultured bacterium [TaxId: 77133]} pgcevcatwnadqapfrlfgntyyvgmkglssvlvtspqghvlidgglpesapkiianig algfriedvklilnshghidhagglaelqrrsnalvaaspsaaldlasgevgpddpqyha lpkyppvkdmrlardggqfnvgpvyltahatpghtpgglswtwqscdgprclnmvyadsi navsrpgfkfsasseypnaladlrhsfetleklpcdvlisahpeasqlwqrleasatggs dafvdpqacrayvaaartlldsrldqekq
Timeline for d5iqka_: