SCOPe 2.08: Domain d5ifal2: 5ifa L:108-212

Lineage for d5ifal2 (5ifa L:108-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)

8. Domain d5ifal2: 5ifa L:108-212 [315118]
   Other proteins in same PDB: d5ifal1
   automated match to d1n0xl2
   complexed with 1pe, gol, so4

Details for d5ifal2

PDB Entry: 5ifa, 1.82 Å

PDB Description: crystal structure of unbound vrc01c-hugl2 fab from an hiv-1 naive donor at 1.82 a

PDB Compounds: (L:) VRC01c-HuGL2 Fab light chain

SCOPe Domain Sequences for d5ifal2:

Sequence, based on SEQRES records:

>d5ifal2 b.1.1.2 (L:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkvyacevthqglrspvtksfnrg

Sequence, based on observed residues (ATOM records):

>d5ifal2 b.1.1.2 (L:108-212) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd
skdstyslsstltlskadyekhkyacevthqglrspvtksfnrg

Timeline for d5ifal2:

• d5ifal2 first appeared in SCOPe 2.06
  
• d5ifal2 appears in SCOPe 2.07