SCOPe 2.08: Domain d5ifal1: 5ifa L:1-107

Lineage for d5ifal1 (5ifa L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5ifal1: 5ifa L:1-107 [315117]
   Other proteins in same PDB: d5ifal2
   automated match to d1n0xl1
   complexed with 1pe, gol, so4

Details for d5ifal1

PDB Entry: 5ifa, 1.82 Å

PDB Description: crystal structure of unbound vrc01c-hugl2 fab from an hiv-1 naive donor at 1.82 a

PDB Compounds: (L:) VRC01c-HuGL2 Fab light chain

SCOPe Domain Sequences for d5ifal1:

Sequence, based on SEQRES records:

>d5ifal1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyysfgggtkveik

Sequence, based on observed residues (ATOM records):

>d5ifal1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqnnknylawyqqkpgqppklliywastresgvpd
rfsgsgsgtdftltisslqaedvavyycqqyysfgggtkveik

Timeline for d5ifal1:

• d5ifal1 first appeared in SCOPe 2.06
  
• d5ifal1 appears in SCOPe 2.07