SCOPe 2.08: Domain d5ioia1: 5ioi A:133-231

Lineage for d5ioia1 (5ioi A:133-231)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.11: Doublecortin (DC) [89837] (1 family)
   possibly related to the ubiquitin-like superfamily

5. Family d.15.11.1: Doublecortin (DC) [89838] (3 proteins)

6. Protein automated matches [190522] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187480] (5 PDB entries)

8. Domain d5ioia1: 5ioi A:133-231 [315111]
   Other proteins in same PDB: d5ioia2, d5ioid2, d5ioie2
   automated match to d1mfwa_

Details for d5ioia1

PDB Entry: 5ioi, 2.4 Å

PDB Description: x-ray structure of the n-terminal domain of human doublecortin

PDB Compounds: (A:) neuronal migration protein doublecortin

SCOPe Domain Sequences for d5ioia1:

Sequence; same for both SEQRES and ATOM records:

>d5ioia1 d.15.11.1 (A:133-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr
kigsmdeleegesyvcssdnffddveytknvnpnwsvnv

Timeline for d5ioia1:

• d5ioia1 first appeared in SCOPe 2.06
  
• d5ioia1 appears in SCOPe 2.07