Lineage for d5ioia1 (5ioi A:133-231)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2935111Superfamily d.15.11: Doublecortin (DC) [89837] (1 family) (S)
    possibly related to the ubiquitin-like superfamily
  5. 2935112Family d.15.11.1: Doublecortin (DC) [89838] (3 proteins)
  6. 2935121Protein automated matches [190522] (1 species)
    not a true protein
  7. 2935122Species Human (Homo sapiens) [TaxId:9606] [187480] (5 PDB entries)
  8. 2935128Domain d5ioia1: 5ioi A:133-231 [315111]
    Other proteins in same PDB: d5ioia2, d5ioid2, d5ioie2
    automated match to d1mfwa_

Details for d5ioia1

PDB Entry: 5ioi (more details), 2.4 Å

PDB Description: x-ray structure of the n-terminal domain of human doublecortin
PDB Compounds: (A:) neuronal migration protein doublecortin

SCOPe Domain Sequences for d5ioia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ioia1 d.15.11.1 (A:133-231) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr
kigsmdeleegesyvcssdnffddveytknvnpnwsvnv

SCOPe Domain Coordinates for d5ioia1:

Click to download the PDB-style file with coordinates for d5ioia1.
(The format of our PDB-style files is described here.)

Timeline for d5ioia1: