Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) contains a common phosphate-binding site |
Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins) |
Protein Methylglyoxal synthase, MgsA [52340] (3 species) |
Species Escherichia coli [TaxId:562] [52341] (5 PDB entries) |
Domain d1eghb_: 1egh B: [31511] complexed with pga |
PDB Entry: 1egh (more details), 2 Å
SCOPe Domain Sequences for d1eghb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eghb_ c.24.1.2 (B:) Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 562]} melttrtlparkhialvahdhckqmlmswverhqplleqhvlyatgttgnlisratgmnv namlsgpmggdqqvgalisegkidvliffwdplnavphdpdvkallrlatvwnipvatnv atadfiiqsphfndavdilipdyqryladrl
Timeline for d1eghb_: