Lineage for d1eghb_ (1egh B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2118472Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 2118473Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 2118517Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (2 proteins)
  6. 2118518Protein Methylglyoxal synthase, MgsA [52340] (3 species)
  7. 2118519Species Escherichia coli [TaxId:562] [52341] (5 PDB entries)
  8. 2118530Domain d1eghb_: 1egh B: [31511]
    complexed with pga

Details for d1eghb_

PDB Entry: 1egh (more details), 2 Å

PDB Description: structure of methylglyoxal synthase complexed with the competitive inhibitor 2-phosphoglycolate
PDB Compounds: (B:) methylglyoxal synthase

SCOPe Domain Sequences for d1eghb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eghb_ c.24.1.2 (B:) Methylglyoxal synthase, MgsA {Escherichia coli [TaxId: 562]}
melttrtlparkhialvahdhckqmlmswverhqplleqhvlyatgttgnlisratgmnv
namlsgpmggdqqvgalisegkidvliffwdplnavphdpdvkallrlatvwnipvatnv
atadfiiqsphfndavdilipdyqryladrl

SCOPe Domain Coordinates for d1eghb_:

Click to download the PDB-style file with coordinates for d1eghb_.
(The format of our PDB-style files is described here.)

Timeline for d1eghb_: