Lineage for d1eghb_ (1egh B:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22377Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
  4. 22378Superfamily c.24.1: Methylglyoxal synthase-like [52335] (2 families) (S)
  5. 22410Family c.24.1.2: Methylglyoxal synthase, MgsA [52339] (1 protein)
  6. 22411Protein Methylglyoxal synthase, MgsA [52340] (1 species)
  7. 22412Species Escherichia coli [TaxId:562] [52341] (2 PDB entries)
  8. 22417Domain d1eghb_: 1egh B: [31511]

Details for d1eghb_

PDB Entry: 1egh (more details), 2 Å

PDB Description: structure of methylglyoxal synthase complexed with the competitive inhibitor 2-phosphoglycolate

SCOP Domain Sequences for d1eghb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eghb_ c.24.1.2 (B:) Methylglyoxal synthase, MgsA {Escherichia coli}
melttrtlparkhialvahdhckqmlmswverhqplleqhvlyatgttgnlisratgmnv
namlsgpmggdqqvgalisegkidvliffwdplnavphdpdvkallrlatvwnipvatnv
atadfiiqsphfndavdilipdyqryladrl

SCOP Domain Coordinates for d1eghb_:

Click to download the PDB-style file with coordinates for d1eghb_.
(The format of our PDB-style files is described here.)

Timeline for d1eghb_: