| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d5i1da1: 5i1d A:1-112 [315108] Other proteins in same PDB: d5i1da2, d5i1db_, d5i1dh_, d5i1dl2 automated match to d1dn0a1 complexed with so4 |
PDB Entry: 5i1d (more details), 2 Å
SCOPe Domain Sequences for d5i1da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i1da1 b.1.1.0 (A:1-112) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyystpltfgqgtkvei
Timeline for d5i1da1:
View in 3DDomains from other chains: (mouse over for more information) d5i1db_, d5i1dh_, d5i1dl1, d5i1dl2 |