Lineage for d5idtc_ (5idt C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. Protein automated matches [191218] (6 species)
    not a true protein
  7. Species Burkholderia vietnamiensis [TaxId:269482] [314952] (3 PDB entries)
  8. Domain d5idtc_: 5idt C: [315097]
    automated match to d1fxob_
    complexed with edo, thm

Details for d5idtc_

PDB Entry: 5idt (more details), 2.3499999999999996 Å

PDB Description: crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis with bound thymidine
PDB Compounds: (C:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d5idtc_:

Sequence, based on SEQRES records: (download)

>d5idtc_ c.68.1.6 (C:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
tqrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagmrdvlvistpqdt
prfqqllgdgsqwgmnlqyavqpspdglaqafiigeqfignapsalvlgdniyyghdfqp
llkaadaqssgatvfayhvhdperygvvqfnaqgqavsieekpkapksnyavtglyfydq
qvvdiakavkpsargeleitsvnqaymqqgqlnvqtmgrgyawldtgthdslldasqfia
tlenrqglkvacpeeiawrsgwinasqlealvqpltkngygqylmqilk

Sequence, based on observed residues (ATOM records): (download)

>d5idtc_ c.68.1.6 (C:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
tqrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagmrdvlvistpqdt
prfqqllgdgsqwgmnlqyavqpspdglaqafiigeqfignapsalvlgdniyyghdfqp
llkaadaqssgatvfayhvhdperygvvqfnaqgqavsieekpkapksnyavtglyfydq
qvvdiakavkpseleitsvnqaymqqgqlnvqtmgrgyawldtgthdslldasqfiatle
nrqglkvacpeeiawrsgwinasqlealvqpltkngygqylmqilk

SCOPe Domain Coordinates for d5idtc_ are not available.

Timeline for d5idtc_:

Domains from other chains:
(mouse over for more information)
d5idta_, d5idtb_, d5idtd_