SCOPe 2.07: Domain d5io9b_: 5io9 B:

Lineage for d5io9b_ (5io9 B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.11: Doublecortin (DC) [89837] (1 family)
   possibly related to the ubiquitin-like superfamily

5. Family d.15.11.1: Doublecortin (DC) [89838] (3 protein domains)

6. Protein automated matches [190522] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187480] (5 PDB entries)

8. Domain d5io9b_: 5io9 B: [315096]
   Other proteins in same PDB: d5io9a2
   automated match to d1mfwa_

Details for d5io9b_

PDB Entry: 5io9, 1.3 Å

PDB Description: x-ray structure of the n-terminal domain of human doublecortin

PDB Compounds: (B:) neuronal migration protein doublecortin

SCOPe Domain Sequences for d5io9b_:

Sequence, based on SEQRES records:

>d5io9b_ d.15.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsdninlpqgvryiytidgsr
kigsmdeleegesyvcssdnffddveytknvnpnwsvn

Sequence, based on observed residues (ATOM records):

>d5io9b_ d.15.11.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akkvrfyrngdryfkgivyavssdrfrsfdalladltrslsnlpqgvryiytidgsrkig
smdeleegesyvcssdnffddveytknvnpnwsvn

Timeline for d5io9b_:

• d5io9b_ first appeared in SCOPe 2.06