Lineage for d5iqkb_ (5iqk B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2602905Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2602906Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (15 families) (S)
  5. 2603526Family d.157.1.0: automated matches [191360] (1 protein)
    not a true family
  6. 2603527Protein automated matches [190418] (31 species)
    not a true protein
  7. 2603944Species Uncultured bacterium [TaxId:77133] [315090] (1 PDB entry)
  8. 2603946Domain d5iqkb_: 5iqk B: [315091]
    automated match to d4awza_
    complexed with zn

Details for d5iqkb_

PDB Entry: 5iqk (more details), 1.75 Å

PDB Description: rm3 metallo-beta-lactamase
PDB Compounds: (B:) beta-lactamase Rm3

SCOPe Domain Sequences for d5iqkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iqkb_ d.157.1.0 (B:) automated matches {Uncultured bacterium [TaxId: 77133]}
tpgcevcatwnadqapfrlfgntyyvgmkglssvlvtspqghvlidgglpesapkiiani
galgfriedvklilnshghidhagglaelqrrsnalvaaspsaaldlasgevgpddpqyh
alpkyppvkdmrlardggqfnvgpvyltahatpghtpgglswtwqscdgprclnmvyads
inavsrpgfkfsasseypnaladlrhsfetleklpcdvlisahpeasqlwqrleasatgg
sdafvdpqacrayvaaartlldsrldqekq

SCOPe Domain Coordinates for d5iqkb_:

Click to download the PDB-style file with coordinates for d5iqkb_.
(The format of our PDB-style files is described here.)

Timeline for d5iqkb_: