SCOPe 2.06: Domain d5im2a_: 5im2 A:

Lineage for d5im2a_ (5im2 A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Rhodoferax ferrireducens [TaxId:338969] [315085] (1 PDB entry)

8. Domain d5im2a_: 5im2 A: [315086]
   automated match to d4p56b_
   complexed with bez

Details for d5im2a_

PDB Entry: 5im2, 1.7 Å

PDB Description: crystal structure of a trap solute binding protein from rhodoferax ferrireducens t118 (rfer_2570, target efi-510210) in complex with copurified benzoate

PDB Compounds: (A:) Twin-arginine translocation pathway signal

SCOPe Domain Sequences for d5im2a_:

Sequence; same for both SEQRES and ATOM records:

>d5im2a_ c.94.1.0 (A:) automated matches {Rhodoferax ferrireducens [TaxId: 338969]}
tvtlkfhtfmapqsnvwqnmhkvwmdkvskesggriqfeaypamqlggspaqlydqakdg
vvdiiwtipgytagrfprievfelpfmmtnaeatsracweymqtmaldefkdtqvlalqv
hgpgvfhtkdkqiktaadlkglkmrgptrqvtkmlgylgaipvgmplpaipdalskgtid
gaalpwevvpsvkvheltrfhsefdpaggalytatfvlamnkasyqalppdlrkiidnns
glqtsgwlgrvqqagdaagrqaalahkntiyaipaleaqefkrkaavvevawvedmnqrg
fdgrqllttaraliakhskvaa

Timeline for d5im2a_:

• d5im2a_ is new in SCOPe 2.06-stable
  
• d5im2a_ appears in SCOPe 2.07
  
• d5im2a_ appears in the current release, SCOPe 2.08