SCOPe 2.08: Domain d5iqpa_: 5iqp A:

Lineage for d5iqpa_ (5iqp A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
   multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix

4. Superfamily a.118.7: 14-3-3 protein [48445] (1 family)
   automatically mapped to Pfam PF00244

5. Family a.118.7.1: 14-3-3 protein [48446] (5 proteins)

6. Protein automated matches [190238] (11 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187008] (56 PDB entries)

8. Domain d5iqpa_: 5iqp A: [315077]
   automated match to d4dnkb_
   complexed with so4

Details for d5iqpa_

PDB Entry: 5iqp, 2.6 Å

PDB Description: 14-3-3 protein tau isoform

PDB Compounds: (A:) 14-3-3 protein theta

SCOPe Domain Sequences for d5iqpa_:

Sequence; same for both SEQRES and ATOM records:

>d5iqpa_ a.118.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mekteliqkaklaeqaeryddmatcmkavteqgaelsneernllsvayknvvggrrsawr
vissieqktdtsdkklqlikdyrekveselrsicttvlelldkylianatnpeskvfylk
mkgdyfrylaevacgddrkqtidnsqgayqeafdiskkemqpthpirlglalnfsvfyye
ilnnpelactlaktafdeaiaeldtlnedsykdstlimqllrdnltlwts

Timeline for d5iqpa_:

• d5iqpa_ first appeared in SCOPe 2.06
  
• d5iqpa_ appears in SCOPe 2.07