SCOPe 2.08: Domain d5hgwa1: 5hgw A:1-171

Lineage for d5hgwa1 (5hgw A:1-171)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (20 species)
   not a true protein

7. Species Burkholderia ambifaria [TaxId:398577] [314942] (1 PDB entry)

8. Domain d5hgwa1: 5hgw A:1-171 [315074]
   Other proteins in same PDB: d5hgwa2, d5hgwb2
   automated match to d4nt8a_
   complexed with edo, fe, so4

Details for d5hgwa1

PDB Entry: 5hgw, 1.6 Å

PDB Description: crystal structure of a peptide deformylase from burkholderia ambifaria

PDB Compounds: (A:) Peptide deformylase

SCOPe Domain Sequences for d5hgwa1:

Sequence; same for both SEQRES and ATOM records:

>d5hgwa1 d.167.1.0 (A:1-171) automated matches {Burkholderia ambifaria [TaxId: 398577]}
mireilkmgdprllevakpvaqfdtpelheivadmfetmhhangaglaapqigiglqiii
fgfgsnnrypdappvpetvlinpkleymppdmeegwegclsvpgmrgvvsryakvrysgy
dqfgakidrvaegfharvvqheydhligklypmritdftrfgftevlfpgl

Timeline for d5hgwa1:

• d5hgwa1 first appeared in SCOPe 2.06
  
• d5hgwa1 appears in SCOPe 2.07