Lineage for d5hznd_ (5hzn D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2981821Protein Insulin-like growth factor 1 receptor [69825] (1 species)
    PTK group; InsR subfamily; membrane spanning protein tyrosine kinase
  7. 2981822Species Human (Homo sapiens) [TaxId:9606] [69826] (18 PDB entries)
  8. 2981848Domain d5hznd_: 5hzn D: [315073]
    automated match to d1p4ob_
    complexed with 66a, mes, so4

Details for d5hznd_

PDB Entry: 5hzn (more details), 2.2 Å

PDB Description: structure of nvp-aew541 in complex with igf-1r kinase
PDB Compounds: (D:) insulin-like growth factor 1 receptor

SCOPe Domain Sequences for d5hznd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hznd_ d.144.1.7 (D:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]}
aadvyvpdewevarekitmsrelgqgsfgmvyegvakgvvkdepetrvaiktvneaasmr
erieflneasvmkefnchhvvrllgvvsqgqptlvimelmtrgdlksylrslrpamannp
vlappslskmiqmageiadgmaylnankfvhrdlaarncmvaedftvkigdfgmtrdiye
tdyyrkggkgllpvrwmspeslkdgvfttysdvwsfgvvlweiatlaeqpyqglsneqvl
rfvmegglldkpdncpdmlfelmrmcwqynpkmrpsfleiissikeemepgfrevsfyys
eenk

SCOPe Domain Coordinates for d5hznd_:

Click to download the PDB-style file with coordinates for d5hznd_.
(The format of our PDB-style files is described here.)

Timeline for d5hznd_: