Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.10: Aldolase [51569] (9 families) Common fold covers whole protein structure |
Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins) hybrid of classes I and II aldolase automatically mapped to Pfam PF00490 |
Protein automated matches [190088] (5 species) not a true protein |
Species Escherichia coli [TaxId:83333] [315066] (1 PDB entry) |
Domain d5ic2a_: 5ic2 A: [315067] automated match to d1l6sa_ complexed with gol, pbg, zn |
PDB Entry: 5ic2 (more details), 2.1 Å
SCOPe Domain Sequences for d5ic2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5ic2a_ c.1.10.3 (A:) automated matches {Escherichia coli [TaxId: 83333]} tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi kragadlifsyfaldlaekkilr
Timeline for d5ic2a_: