Lineage for d5ic2a_ (5ic2 A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2096922Superfamily c.1.10: Aldolase [51569] (9 families) (S)
    Common fold covers whole protein structure
  5. 2097845Family c.1.10.3: 5-aminolaevulinate dehydratase, ALAD (porphobilinogen synthase) [51594] (2 proteins)
    hybrid of classes I and II aldolase
    automatically mapped to Pfam PF00490
  6. 2097887Protein automated matches [190088] (5 species)
    not a true protein
  7. 2097892Species Escherichia coli [TaxId:83333] [315066] (1 PDB entry)
  8. 2097893Domain d5ic2a_: 5ic2 A: [315067]
    automated match to d1l6sa_
    complexed with gol, pbg, zn

Details for d5ic2a_

PDB Entry: 5ic2 (more details), 2.1 Å

PDB Description: product-complex of e.coli 5-amino laevulinic acid dehydratase
PDB Compounds: (A:) delta-aminolevulinic acid dehydratase

SCOPe Domain Sequences for d5ic2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ic2a_ c.1.10.3 (A:) automated matches {Escherichia coli [TaxId: 83333]}
tdliqrprrlrkspalramfeettlslndlvlpifveeeiddykaveampgvmripekhl
areierianagirsvmtfgishhtdetgsdawredglvarmsrickqtvpemivmsdtcf
ceytshghcgvlcehgvdndatlenlgkqavvaaaagadfiapsaamdgqvqairqalda
agfkdtaimsystkfassfygpfreaagsalkgdrksyqmnpmnrreaireslldeaqga
dclmvkpagayldivrelrertelpigayqvsgeyamikfaalagaideekvvleslgsi
kragadlifsyfaldlaekkilr

SCOPe Domain Coordinates for d5ic2a_:

Click to download the PDB-style file with coordinates for d5ic2a_.
(The format of our PDB-style files is described here.)

Timeline for d5ic2a_: