Lineage for d5iiha1 (5iih A:4-195)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2730252Fold a.126: Serum albumin-like [48551] (1 superfamily)
    multihelical; one domain consists of two similar disulfide-linked subdomains
  4. 2730253Superfamily a.126.1: Serum albumin-like [48552] (2 families) (S)
  5. 2730697Family a.126.1.0: automated matches [254216] (1 protein)
    not a true family
  6. 2730698Protein automated matches [254493] (6 species)
    not a true protein
  7. 2730752Species Horse (Equus caballus) [TaxId:9796] [256129] (26 PDB entries)
  8. 2730810Domain d5iiha1: 5iih A:4-195 [315057]
    automated match to d1hk5a2
    complexed with so4, zn

Details for d5iiha1

PDB Entry: 5iih (more details), 2.4 Å

PDB Description: crystal structure of equine serum albumin in the presence of 2.5 mm zinc at ph 7.4
PDB Compounds: (A:) serum albumin

SCOPe Domain Sequences for d5iiha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5iiha1 a.126.1.0 (A:4-195) automated matches {Horse (Equus caballus) [TaxId: 9796]}
kseiahrfndlgekhfkglvlvafsqylqqcpfedhvklvnevtefakkcaadesaencd
kslhtlfgdklctvatlratygeladccekqepernecflthkddhpnlpklkpepdaqc
aafqedpdkflgkylyevarrhpyfygpellfhaeeykadfteccpaddklaclipklda
lkerillssake

SCOPe Domain Coordinates for d5iiha1:

Click to download the PDB-style file with coordinates for d5iiha1.
(The format of our PDB-style files is described here.)

Timeline for d5iiha1: