Lineage for d5idva_ (5idv A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2123292Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2123293Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2128217Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2128218Protein automated matches [190123] (130 species)
    not a true protein
  7. 2128221Species Acinetobacter baumannii [TaxId:1116234] [315046] (1 PDB entry)
  8. 2128222Domain d5idva_: 5idv A: [315047]
    automated match to d1jj7a_
    complexed with edo

Details for d5idva_

PDB Entry: 5idv (more details), 1.45 Å

PDB Description: structure of the nucleotide binding domain of an abc transporter msba from acinetobacter baumannii
PDB Compounds: (A:) Lipid A export ATP-binding/permease protein msbA

SCOPe Domain Sequences for d5idva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5idva_ c.37.1.0 (A:) automated matches {Acinetobacter baumannii [TaxId: 1116234]}
felldlpeeqnsgelkpqlqgairfdhvvlnyadgtqaikdfsldirpgetvalvgrsga
gktslvnmlvrfqevssgqiylddlpirdielsslrtqiamvnqqvvlfnrtvreniayg
qlhnasdedviaaakaayahdfimnlpngydtvlgaqglnlsggqrqriaiarailknap
ilildeatsaldnesehfiqqafdeamqdrttiviahrlstienadrivvmdrgqiveqg
thqellakhgayyqlhqrnfedh

SCOPe Domain Coordinates for d5idva_:

Click to download the PDB-style file with coordinates for d5idva_.
(The format of our PDB-style files is described here.)

Timeline for d5idva_: