![]() | Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
![]() | Fold e.6: Acyl-CoA dehydrogenase NM domain-like [56644] (1 superfamily) 2 domains: (1) all-alpha: 5 helices; (2) contains an open beta-sheet barrel: n*=5, S*=8; complex topology |
![]() | Superfamily e.6.1: Acyl-CoA dehydrogenase NM domain-like [56645] (3 families) ![]() flavoprotein: binds FAD; constituent families differ in the numbers of C-terminal domains (four-helical bundles) |
![]() | Family e.6.1.0: automated matches [227203] (1 protein) not a true family |
![]() | Protein automated matches [226934] (25 species) not a true protein |
![]() | Species Burkholderia phymatum [TaxId:391038] [314995] (1 PDB entry) |
![]() | Domain d5idub1: 5idu B:6-238 [315044] Other proteins in same PDB: d5idua2, d5idub2, d5iduc2, d5iduc3, d5idud2 automated match to d4p13a1 complexed with edo, fad |
PDB Entry: 5idu (more details), 1.95 Å
SCOPe Domain Sequences for d5idub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5idub1 e.6.1.0 (B:6-238) automated matches {Burkholderia phymatum [TaxId: 391038]} idphgalawpffearhrelaagieawatqhlacvqhddtdttcrklvralgeagwlkygv ggaqygghgdtidtravcllretlanhdgladfalamqglgsgaitlagtheqkirylpr vskgeaiaafalsepdagsdvaamslqaraegdcyvidgdktwisnggiadfyvvfartg eapgargisafivdadtpglqiaeridviaphplarlhfdsarvprsqmlgap
Timeline for d5idub1: