SCOPe 2.08: Domain d5fhxl1: 5fhx L:1-111

Lineage for d5fhxl1 (5fhx L:1-111)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5fhxl1: 5fhx L:1-111 [315038]
   Other proteins in same PDB: d5fhxa_
   automated match to d1ejol1
   complexed with po4

Details for d5fhxl1

PDB Entry: 5fhx, 2.55 Å

PDB Description: crystal structure of codv in complex with il4 at 2.55 ang. resolution.

PDB Compounds: (L:) Antibody fragment Light chain

SCOPe Domain Sequences for d5fhxl1:

Sequence; same for both SEQRES and ATOM records:

>d5fhxl1 b.1.1.0 (L:1-111) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divltqspaslavslgqratiscrasesvdsygqsymhwyqqkagqppklliylasnles
gvparfsgsgsrtdftltidpvqaedaatyycqqnaedsrtfgggtkleik

Timeline for d5fhxl1:

• d5fhxl1 first appeared in SCOPe 2.06
  
• d5fhxl1 appears in SCOPe 2.07