Lineage for d5idtd_ (5idt D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2898275Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 2898276Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 2898466Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins)
    automatically mapped to Pfam PF00483
  6. 2898597Protein automated matches [191218] (6 species)
    not a true protein
  7. 2898598Species Burkholderia vietnamiensis [TaxId:269482] [314952] (3 PDB entries)
  8. 2898612Domain d5idtd_: 5idt D: [315035]
    automated match to d1fxob_
    complexed with edo, thm

Details for d5idtd_

PDB Entry: 5idt (more details), 2.35 Å

PDB Description: crystal structure of a glucose-1-phosphate thymidylyltransferase from burkholderia vietnamiensis with bound thymidine
PDB Compounds: (D:) glucose-1-phosphate thymidylyltransferase

SCOPe Domain Sequences for d5idtd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5idtd_ c.68.1.6 (D:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]}
tqrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagmrdvlvistpqdt
prfqqllgdgsqwgmnlqyavqpspdglaqafiigeqfignapsalvlgdniyyghdfqp
llkaadaqssgatvfayhvhdperygvvqfnaqgqavsieekpkapksnyavtglyfydq
qvvdiakavkpsargeleitsvnqaymqqgqlnvqtmgrgyawldtgthdslldasqfia
tlenrqglkvacpeeiawrsgwinasqlealvqpltkngygqylmqilk

SCOPe Domain Coordinates for d5idtd_:

Click to download the PDB-style file with coordinates for d5idtd_.
(The format of our PDB-style files is described here.)

Timeline for d5idtd_: