SCOPe 2.08: Domain d5i2rd1: 5i2r D:457-768

Lineage for d5i2rd1 (5i2r D:457-768)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
   multihelical; consists of two different alpha-helical bundles

4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families)

5. Family a.211.1.0: automated matches [191566] (1 protein)
   not a true family

6. Protein automated matches [190983] (12 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188676] (139 PDB entries)

8. Domain d5i2rd1: 5i2r D:457-768 [315034]
   Other proteins in same PDB: d5i2rd2
   automated match to d5axqb_
   complexed with 67a, mg, zn

Details for d5i2rd1

PDB Entry: 5i2r, 2.5 Å

PDB Description: human pde10a in complex with 3-(2-phenylpyrazol-3-yl)-1-[3- (trifluoromethoxy)phenyl]pyridazin-4-one

PDB Compounds: (D:) cAMP and cAMP-inhibited cGMP 3',5'-cyclic phosphodiesterase 10A

SCOPe Domain Sequences for d5i2rd1:

Sequence; same for both SEQRES and ATOM records:

>d5i2rd1 a.211.1.0 (D:457-768) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qglmqftlpvrlckeielfhfdigpfenmwpgifvymvhrscgtscfeleklcrfimsvk
knyrrvpyhnwkhavtvahcmyailqnnhtlftdlerkglliaclchdldhrgfsnsylq
kfdhplaalyststmeqhhfsqtvsilqleghnifstlssseyeqvleiirkaiiatdla
lyfgnrkqleemyqtgslnlnnqshrdrviglmmtacdlcsvtklwpvtkltandiyaef
waegdemkklgiqpipmmdrdkkdevpqgqlgfynavaipcyttltqilpptepllkacr
dnlsqwekvirg

Timeline for d5i2rd1:

• d5i2rd1 first appeared in SCOPe 2.06
  
• d5i2rd1 appears in SCOPe 2.07