Lineage for d5hexb3 (5hex B:466-670)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2883384Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 2884835Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 2884836Protein automated matches [226839] (64 species)
    not a true protein
  7. 2885061Species Human (Homo sapiens) [TaxId:9606] [224896] (72 PDB entries)
  8. 2885249Domain d5hexb3: 5hex B:466-670 [315032]
    automated match to d2nzta3
    complexed with 604

Details for d5hexb3

PDB Entry: 5hex (more details), 2.73 Å

PDB Description: crystal structure of human hexokinase 2 with cmpd 30, a 2-amino-6- benzenesulfonamide glucosamine
PDB Compounds: (B:) Hexokinase-2

SCOPe Domain Sequences for d5hexb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hexb3 c.55.1.0 (B:466-670) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qhrarqktlehlqlshdqllevkrrmkvemerglskethasapvkmlptyvcatpdgtek
gdflaldlggtnfrvllvrvrngkwggvemhnkiyaipqevmhgtgdelfdhivqciadf
leymgmkgvslplgftfsfpcqqnsldesillkwtkgfkasgcegedvvtllkeaihrre
efdldvvavvndtvgtmmtcgfedp

SCOPe Domain Coordinates for d5hexb3:

Click to download the PDB-style file with coordinates for d5hexb3.
(The format of our PDB-style files is described here.)

Timeline for d5hexb3: