| Class c: Alpha and beta proteins (a/b) [51349] (136 folds) |
| Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) ![]() contains a common phosphate-binding site |
| Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein) |
| Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species) |
| Species Escherichia coli [TaxId:562] [52338] (10 PDB entries) |
| Domain d1jdbb2: 1jdb B:936-1072 [31503] Other proteins in same PDB: d1jdbb1, d1jdbb3, d1jdbb4, d1jdbb5, d1jdbb6, d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh3, d1jdbh4, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2 |
PDB Entry: 1jdb (more details), 2.1 Å
SCOP Domain Sequences for d1jdbb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jdbb2 c.24.1.1 (B:936-1072) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli}
stmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvhe
grphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamalna
datekvisvqemhaqik
Timeline for d1jdbb2:
View in 3DDomains from other chains: (mouse over for more information) d1jdbc1, d1jdbc2, d1jdbe1, d1jdbe2, d1jdbe3, d1jdbe4, d1jdbe5, d1jdbe6, d1jdbf1, d1jdbf2, d1jdbh1, d1jdbh2, d1jdbh3, d1jdbh4, d1jdbh5, d1jdbh6, d1jdbi1, d1jdbi2, d1jdbk1, d1jdbk2, d1jdbk3, d1jdbk4, d1jdbk5, d1jdbk6, d1jdbl1, d1jdbl2 |