Lineage for d5h8hb_ (5h8h B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2913609Family c.94.1.1: Phosphate binding protein-like [53851] (45 proteins)
    has additional insertions and/or extensions that are not grouped together
  6. 2914403Protein N-methyl-D-aspartate receptor subunit 1 [89787] (3 species)
  7. 2914404Species Human (Homo sapiens) [TaxId:9606] [314718] (10 PDB entries)
  8. 2914409Domain d5h8hb_: 5h8h B: [315028]
    Other proteins in same PDB: d5h8ha_
    automated match to d1pb7a_
    complexed with 5yc, act, ca, glu, gly

Details for d5h8hb_

PDB Entry: 5h8h (more details), 2.23 Å

PDB Description: structure of the human glun1/glun2a lbd in complex with gne3419
PDB Compounds: (B:) Glutamate receptor ionotropic, NMDA 1,Glutamate receptor ionotropic, NMDA 1

SCOPe Domain Sequences for d5h8hb_:

Sequence, based on SEQRES records: (download)

>d5h8hb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Human (Homo sapiens) [TaxId: 9606]}
mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq
ccygfcidlliklartmnftyevhlvadgkfgtqervnnsnkkewngmmgellsgqadmi
vapltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssv
diyfrrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvtt
gelffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvr

Sequence, based on observed residues (ATOM records): (download)

>d5h8hb_ c.94.1.1 (B:) N-methyl-D-aspartate receptor subunit 1 {Human (Homo sapiens) [TaxId: 9606]}
mstrlkivtihqepfvyvkptlsdgtckeeftvngdpvkkvictgpndtspgsprhtvpq
ccygfcidlliklartmnftyevhlvadgkfgtqervnkkewngmmgellsgqadmivap
ltinneraqyiefskpfkyqgltilvkkgtritgindprlrnpsdkfiyatvkqssvdiy
frrqvelstmyrhmekhnyesaaeaiqavrdnklhafiwdsavlefeasqkcdlvttgel
ffrsgfgigmrkdspwkqnvslsilkshengfmedldktwvr

SCOPe Domain Coordinates for d5h8hb_:

Click to download the PDB-style file with coordinates for d5h8hb_.
(The format of our PDB-style files is described here.)

Timeline for d5h8hb_: