SCOPe 2.07: Domain d5ie9c_: 5ie9 C:

Lineage for d5ie9c_ (5ie9 C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (5 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.2: MazG-like [116993] (4 proteins)
   Pfam PF03819

6. Protein automated matches [315024] (1 species)
   not a true protein

7. Species Bacillus cereus [TaxId:1396] [315025] (1 PDB entry)

8. Domain d5ie9c_: 5ie9 C: [315026]
   automated match to d2gtab1
   complexed with mn

Details for d5ie9c_

PDB Entry: 5ie9, 2.8 Å

PDB Description: crystal structure of the bacillus-conserved mazg protein, a nucleotide pyrophosphohydrolase

PDB Compounds: (C:) Nucleotide pyrophosphohydrolase

SCOPe Domain Sequences for d5ie9c_:

Sequence, based on SEQRES records:

>d5ie9c_ a.204.1.2 (C:) automated matches {Bacillus cereus [TaxId: 1396]}
meaktmkdmqkevdayigqfkegyfsplammarlteemgelarevnhyygekpkktteke
rsieeelgdvlfvmicmanslnidletahnivmnkfntrdkdr

Sequence, based on observed residues (ATOM records):

>d5ie9c_ a.204.1.2 (C:) automated matches {Bacillus cereus [TaxId: 1396]}
meaktmkdmqkevdayigqfkegyfsplammarlteemgelarevnhyygeersieeelg
dvlfvmicmanslnidletahnivmnkfntrdkdr

Timeline for d5ie9c_:

• d5ie9c_ first appeared in SCOPe 2.06