SCOPe 2.07: Domain d5idua2: 5idu A:239-397

Lineage for d5idua2 (5idu A:239-397)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (30 species)
   not a true protein

7. Species Burkholderia phymatum [TaxId:391038] [314997] (1 PDB entry)

8. Domain d5idua2: 5idu A:239-397 [314998]
   Other proteins in same PDB: d5idua1, d5idub1, d5iduc1, d5iduc3, d5idud1
   automated match to d1egda1
   complexed with edo, fad

Details for d5idua2

PDB Entry: 5idu, 1.95 Å

PDB Description: crystal structure of an acyl-coa dehydrogenase domain protein from burkholderia phymatum bound to fad

PDB Compounds: (A:) Acyl-CoA dehydrogenase domain protein

SCOPe Domain Sequences for d5idua2:

Sequence; same for both SEQRES and ATOM records:

>d5idua2 a.29.3.0 (A:239-397) automated matches {Burkholderia phymatum [TaxId: 391038]}
gegfkiamrtldvfrtsvaaaslgfarralqeglaraasrkmfgqtlgdfqltqtklaqm
altidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlwggmgvqsgtt
verlyreiralriyegatevqqlivgrdllkahaaqrqq

Timeline for d5idua2:

• d5idua2 first appeared in SCOPe 2.06