![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
![]() | Protein automated matches [226935] (30 species) not a true protein |
![]() | Species Burkholderia phymatum [TaxId:391038] [314997] (1 PDB entry) |
![]() | Domain d5idua2: 5idu A:239-397 [314998] Other proteins in same PDB: d5idua1, d5idub1, d5iduc1, d5iduc3, d5idud1 automated match to d1egda1 complexed with edo, fad |
PDB Entry: 5idu (more details), 1.95 Å
SCOPe Domain Sequences for d5idua2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5idua2 a.29.3.0 (A:239-397) automated matches {Burkholderia phymatum [TaxId: 391038]} gegfkiamrtldvfrtsvaaaslgfarralqeglaraasrkmfgqtlgdfqltqtklaqm altidssallvyraawlrdqgenvtreaamakwhasegaqqvidaavqlwggmgvqsgtt verlyreiralriyegatevqqlivgrdllkahaaqrqq
Timeline for d5idua2: