Lineage for d5ig4c_ (5ig4 C:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2935697Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 2936287Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 2937177Family d.17.4.0: automated matches [191337] (1 protein)
    not a true family
  6. 2937178Protein automated matches [190205] (35 species)
    not a true protein
  7. 2937273Species Nematostella vectensis [TaxId:45351] [314982] (1 PDB entry)
  8. 2937276Domain d5ig4c_: 5ig4 C: [314994]
    automated match to d1hkxe_
    complexed with gol

Details for d5ig4c_

PDB Entry: 5ig4 (more details), 2.35 Å

PDB Description: crystal structure of n. vectensis camkii-a hub
PDB Compounds: (C:) Predicted protein

SCOPe Domain Sequences for d5ig4c_:

Sequence, based on SEQRES records: (download)

>d5ig4c_ d.17.4.0 (C:) automated matches {Nematostella vectensis [TaxId: 45351]}
takvreqeiirltqklitsittgdydtysklvdphvtcfepfsngnlveglefhkfyfdn
tlskrsvpinttilsphvhvlgedaacicymrltqsvnssgeaktlqqeetrvwqkkggn
winvhfhisg

Sequence, based on observed residues (ATOM records): (download)

>d5ig4c_ d.17.4.0 (C:) automated matches {Nematostella vectensis [TaxId: 45351]}
takvreqeiirltqklitsittgdydtysklvdphvtcfepfsngnlveglefhkfyfdn
tlskvpinttilsphvhvlgedaacicymrltqsvnssgeaktlqqeetrvwqkkggnwi
nvhfhisg

SCOPe Domain Coordinates for d5ig4c_:

Click to download the PDB-style file with coordinates for d5ig4c_.
(The format of our PDB-style files is described here.)

Timeline for d5ig4c_: