![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.7: Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A [89851] (2 proteins) automatically mapped to Pfam PF13474 automatically mapped to Pfam PF08332 |
![]() | Protein automated matches [190404] (2 species) not a true protein |
![]() | Species Nematostella vectensis [TaxId:45351] [314988] (1 PDB entry) |
![]() | Domain d5ig5e1: 5ig5 E:333-474 [314989] Other proteins in same PDB: d5ig5a2, d5ig5b2, d5ig5c2, d5ig5e2, d5ig5f2, d5ig5g2 automated match to d1hkxe_ |
PDB Entry: 5ig5 (more details), 3 Å
SCOPe Domain Sequences for d5ig5e1:
Sequence, based on SEQRES records: (download)
>d5ig5e1 d.17.4.7 (E:333-474) automated matches {Nematostella vectensis [TaxId: 45351]} tiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqvegl efhkfyfdnlpnkrnttvnttilaphvqmlgeegacisyvrltqgigpdglprttqseet rvwqkkkgvwlnvhfhrsvsrp
>d5ig5e1 d.17.4.7 (E:333-474) automated matches {Nematostella vectensis [TaxId: 45351]} tiieedtestktqreqeiirltqqlitsitakdfdsysklvdpkitafepealgnqvegl efhkfyfdnlptvnttilaphvqmlgeegacisyvrltqgigpdglprttqseetrvwqk kkgvwlnvhfhrsvsrp
Timeline for d5ig5e1: