Lineage for d5i67a2 (5i67 A:245-605)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160696Fold c.91: PEP carboxykinase-like [53794] (1 superfamily)
    contains a P-loop NTP-binding motif; mixed beta-sheet folds into a barrel-like structure with helices packed on one side
  4. 2160697Superfamily c.91.1: PEP carboxykinase-like [53795] (3 families) (S)
  5. 2160825Family c.91.1.0: automated matches [196141] (1 protein)
    not a true family
  6. 2160826Protein automated matches [196142] (6 species)
    not a true protein
  7. 2160851Species Mycobacterium tuberculosis [TaxId:419947] [260617] (8 PDB entries)
  8. 2160859Domain d5i67a2: 5i67 A:245-605 [314980]
    Other proteins in same PDB: d5i67a1
    automated match to d4rcga2
    complexed with gdp, mn, peg; mutant

Details for d5i67a2

PDB Entry: 5i67 (more details), 2.6 Å

PDB Description: crystal structure analysis of mtb pepck mutant c273s
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d5i67a2:

Sequence, based on SEQRES records: (download)

>d5i67a2 c.91.1.0 (A:245-605) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
wlaehmlilklispenkayyfaaafpsasgktnlamlqptipgwraetlgddiawmrfgk
dgrlyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpq
hlidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrktt
vplvteardwqhgvfigatlgseqtaaaegkvgnvrrdpmamlpflgynvgdyfqhwinl
gkhadesklpkvffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvp
avedldldgldvdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalker
lg

Sequence, based on observed residues (ATOM records): (download)

>d5i67a2 c.91.1.0 (A:245-605) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
wlaehmlilklispenkayyfaaafpsasgktnlamlqptipgwraetlgddiawmrfgk
dglyavnpefgffgvapgtnwksnpnamrtiaagntvftnvaltddgdvwweglegdpqh
lidwkgndwyfretetnaahpnsryctpmsqcpilapewddpqgvpisgilfggrrkttv
plvteardwqhgvfigatlgsenvrrdpmamlpflgynvgdyfqhwinlgkhadesklpk
vffvnwfrrgddgrflwpgfgensrvlkwivdriehkaggattpigtvpavedldldgld
vdaadvaaalavdadewrqelplieewlqfvgeklptgvkdefdalkerlg

SCOPe Domain Coordinates for d5i67a2:

Click to download the PDB-style file with coordinates for d5i67a2.
(The format of our PDB-style files is described here.)

Timeline for d5i67a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5i67a1