Lineage for d5i67a1 (5i67 A:8-244)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2168058Fold c.109: PEP carboxykinase N-terminal domain [68922] (1 superfamily)
    contains mixed beta-sheets; topology is partly similar to that of the catalytic C-terminal domain
  4. 2168059Superfamily c.109.1: PEP carboxykinase N-terminal domain [68923] (2 families) (S)
  5. 2168155Family c.109.1.0: automated matches [227144] (1 protein)
    not a true family
  6. 2168156Protein automated matches [226847] (5 species)
    not a true protein
  7. 2168178Species Mycobacterium tuberculosis [TaxId:419947] [260615] (8 PDB entries)
  8. 2168186Domain d5i67a1: 5i67 A:8-244 [314979]
    Other proteins in same PDB: d5i67a2
    automated match to d4rcga1
    complexed with gdp, mn, peg; mutant

Details for d5i67a1

PDB Entry: 5i67 (more details), 2.6 Å

PDB Description: crystal structure analysis of mtb pepck mutant c273s
PDB Compounds: (A:) Phosphoenolpyruvate carboxykinase [GTP]

SCOPe Domain Sequences for d5i67a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i67a1 c.109.1.0 (A:8-244) automated matches {Mycobacterium tuberculosis [TaxId: 419947]}
gldtaptnhqgllswveevaeltqpdrvvftdgseeefqrlcdqlveagtfirlnpekhk
nsylalsdpsdvarvesrtyicsakeidagptnnwmdpgemrsimkdlyrgcmrgrtmyv
vpfcmgplgaedpklgveitdseyvvvsmrtmtrmgkaalekmgddgffvkalhsvgapl
epgqkdvawpcsetkyithfpetreiwsygsgyggnallgkkcyslriasamahdeg

SCOPe Domain Coordinates for d5i67a1:

Click to download the PDB-style file with coordinates for d5i67a1.
(The format of our PDB-style files is described here.)

Timeline for d5i67a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5i67a2