SCOPe 2.08: Domain d5iesl1: 5ies L:1-107

Lineage for d5iesl1 (5ies L:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries)

8. Domain d5iesl1: 5ies L:1-107 [314974]
   Other proteins in same PDB: d5iesl2
   automated match to d1n0xl1
   complexed with gol, nag

Details for d5iesl1

PDB Entry: 5ies, 2.16 Å

PDB Description: crystal structure of vrc01c-hugl2 fab from an hiv-1 naive donor in complex with with a germline-targeting gp120 engineered outer domain eod-gt8 at 2.16 a

PDB Compounds: (L:) VRC01cHuGL2 Fab light chain

SCOPe Domain Sequences for d5iesl1:

Sequence, based on SEQRES records:

>d5iesl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqsvlyssnnknylawyqqkpgqppklliywastr
esgvpdrfsgsgsgtdftltisslqaedvavyycqqyysfgggtkveik

Sequence, based on observed residues (ATOM records):

>d5iesl1 b.1.1.0 (L:1-107) automated matches {Human (Homo sapiens) [TaxId: 9606]}
divmtqspdslavslgeratinckssqknylawyqqkpgqppklliywastresgvpdrf
sgsgsgtdftltisslqaedvavyycqqyysfgggtkveik

Timeline for d5iesl1:

• d5iesl1 first appeared in SCOPe 2.06
  
• d5iesl1 appears in SCOPe 2.07