Lineage for d1ce8e2 (1ce8 E:936-1073)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22377Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
  4. 22378Superfamily c.24.1: Methylglyoxal synthase-like [52335] (2 families) (S)
  5. 22379Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 22380Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 22381Species Escherichia coli [TaxId:562] [52338] (7 PDB entries)
  8. 22400Domain d1ce8e2: 1ce8 E:936-1073 [31497]
    Other proteins in same PDB: d1ce8a1, d1ce8a3, d1ce8a4, d1ce8a5, d1ce8a6, d1ce8b1, d1ce8b2, d1ce8c1, d1ce8c3, d1ce8c4, d1ce8c5, d1ce8c6, d1ce8d1, d1ce8d2, d1ce8e1, d1ce8e3, d1ce8e4, d1ce8e5, d1ce8e6, d1ce8f1, d1ce8f2, d1ce8g1, d1ce8g3, d1ce8g4, d1ce8g5, d1ce8g6, d1ce8h1, d1ce8h2

Details for d1ce8e2

PDB Entry: 1ce8 (more details), 2.1 Å

PDB Description: carbamoyl phosphate synthetase from escherichis coli with complexed with the allosteric ligand imp

SCOP Domain Sequences for d1ce8e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ce8e2 c.24.1.1 (E:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOP Domain Coordinates for d1ce8e2:

Click to download the PDB-style file with coordinates for d1ce8e2.
(The format of our PDB-style files is described here.)

Timeline for d1ce8e2: