![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.129: TBP-like [55944] (11 superfamilies) beta-alpha-beta(4)-alpha |
![]() | Superfamily d.129.3: Bet v1-like [55961] (11 families) ![]() contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix |
![]() | Family d.129.3.2: STAR domain [55966] (5 proteins) automatically mapped to Pfam PF01852 |
![]() | Protein automated matches [314967] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [314968] (1 PDB entry) |
![]() | Domain d5i9ja_: 5i9j A: [314969] automated match to d1em2a_ complexed with edo, so4, tla |
PDB Entry: 5i9j (more details), 1.74 Å
SCOPe Domain Sequences for d5i9ja_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i9ja_ d.129.3.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} fsaqereyirqgkeatavvdqilaqeenwkfeknneygdtvytievpfhgktfilktflp cpaelvyqevilqpermvlwnktvtacqilqrvedntlisydvsagaaggvvsprdfvnv rrierrrdrylssgiatshsakppthkyvrgengpggfivlksasnprvctfvwilntdl kgrlprylihqslaatmfefafhlrqriselgar
Timeline for d5i9ja_: