Lineage for d5i9ja_ (5i9j A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975647Family d.129.3.2: STAR domain [55966] (5 proteins)
    automatically mapped to Pfam PF01852
  6. 2975667Protein automated matches [314967] (1 species)
    not a true protein
  7. 2975668Species Human (Homo sapiens) [TaxId:9606] [314968] (1 PDB entry)
  8. 2975669Domain d5i9ja_: 5i9j A: [314969]
    automated match to d1em2a_
    complexed with edo, so4, tla

Details for d5i9ja_

PDB Entry: 5i9j (more details), 1.74 Å

PDB Description: structure of the cholesterol and lutein-binding domain of human stard3 at 1.74a
PDB Compounds: (A:) StAR-related lipid transfer protein 3

SCOPe Domain Sequences for d5i9ja_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i9ja_ d.129.3.2 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fsaqereyirqgkeatavvdqilaqeenwkfeknneygdtvytievpfhgktfilktflp
cpaelvyqevilqpermvlwnktvtacqilqrvedntlisydvsagaaggvvsprdfvnv
rrierrrdrylssgiatshsakppthkyvrgengpggfivlksasnprvctfvwilntdl
kgrlprylihqslaatmfefafhlrqriselgar

SCOPe Domain Coordinates for d5i9ja_:

Click to download the PDB-style file with coordinates for d5i9ja_.
(The format of our PDB-style files is described here.)

Timeline for d5i9ja_: