Class f: Membrane and cell surface proteins and peptides [56835] (59 folds) |
Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) automatically mapped to Pfam PF02764 |
Family f.1.2.0: automated matches [254320] (1 protein) not a true family |
Protein automated matches [254734] (1 species) not a true protein |
Species Corynebacterium diphtheriae [TaxId:1717] [256177] (3 PDB entries) |
Domain d5i82b2: 5i82 B:200-380 [314962] Other proteins in same PDB: d5i82a1, d5i82a3, d5i82b1, d5i82b3, d5i82c1, d5i82c3, d5i82d1, d5i82d3 automated match to d1ddta3 complexed with gol, so4; mutant |
PDB Entry: 5i82 (more details), 2.35 Å
SCOPe Domain Sequences for d5i82b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i82b2 f.1.2.0 (B:200-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]} scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa y
Timeline for d5i82b2: