Lineage for d5i82b2 (5i82 B:200-380)

  1. Root: SCOPe 2.06
  2. 2250849Class f: Membrane and cell surface proteins and peptides [56835] (59 folds)
  3. 2250850Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
    multi-helical domains of various folds which is thought to unfold in the membrane
  4. 2250866Superfamily f.1.2: Diphtheria toxin, middle domain [56845] (2 families) (S)
    automatically mapped to Pfam PF02764
  5. 2250881Family f.1.2.0: automated matches [254320] (1 protein)
    not a true family
  6. 2250882Protein automated matches [254734] (1 species)
    not a true protein
  7. 2250883Species Corynebacterium diphtheriae [TaxId:1717] [256177] (3 PDB entries)
  8. 2250888Domain d5i82b2: 5i82 B:200-380 [314962]
    Other proteins in same PDB: d5i82a1, d5i82a3, d5i82b1, d5i82b3, d5i82c1, d5i82c3, d5i82d1, d5i82d3
    automated match to d1ddta3
    complexed with gol, so4; mutant

Details for d5i82b2

PDB Entry: 5i82 (more details), 2.35 Å

PDB Description: first crystal structure of e.coli based recombinant diphtheria toxin mutant crm197
PDB Compounds: (B:) diphtheria toxin

SCOPe Domain Sequences for d5i82b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i82b2 f.1.2.0 (B:200-380) automated matches {Corynebacterium diphtheriae [TaxId: 1717]}
scinldwdvirdktktkieslkehgpiknkmsespnktvseekakqyleefhqtalehpe
lselktvtgtnpvfaganyaawavnvaqvidsetadnlekttaalsilpgigsvmgiadg
avhhnteeivaqsialsslmvaqaiplvgelvdigfaaynfvesiinlfqvvhnsynrpa
y

SCOPe Domain Coordinates for d5i82b2:

Click to download the PDB-style file with coordinates for d5i82b2.
(The format of our PDB-style files is described here.)

Timeline for d5i82b2: