SCOPe 2.06: Domain d5i5jb2: 5i5j B:499-627

Lineage for d5i5jb2 (5i5j B:499-627)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.0: automated matches [191502] (1 protein)
   not a true family

6. Protein automated matches [190824] (23 species)
   not a true protein

7. Species Shewanella denitrificans [TaxId:318161] [314881] (3 PDB entries)

8. Domain d5i5jb2: 5i5j B:499-627 [314960]
   Other proteins in same PDB: d5i5ja1, d5i5jb1
   automated match to d1qnia1

Details for d5i5jb2

PDB Entry: 5i5j, 2.55 Å

PDB Description: shewanella denitrificans nitrous oxide reductase, reduced apo form

PDB Compounds: (B:) nitrous-oxide reductase

SCOPe Domain Sequences for d5i5jb2:

Sequence, based on SEQRES records:

>d5i5jb2 b.6.1.0 (B:499-627) automated matches {Shewanella denitrificans [TaxId: 318161]}
klwtrddpmfadtvamakqdgvtlemdnkvirdgnkvrvymtsiapnfgmnefkvklgde
vtvvvtnldqvedvthgfcmtnhgvqmevapqatasvtfiankpgvqwyycnwfchalhm
emrgrmlve

Sequence, based on observed residues (ATOM records):

>d5i5jb2 b.6.1.0 (B:499-627) automated matches {Shewanella denitrificans [TaxId: 318161]}
klwtrddpmfadtvamakqdgvtlemdnkvirdgnkvrvymtsianfgmnefkvklgdev
tvvvtnldqvedvthgfcmtnhgvqmevapqatasvtfiankpgvqwyycnwrgrmlve

Timeline for d5i5jb2:

• d5i5jb2 is new in SCOPe 2.06-stable
  
• d5i5jb2 appears in SCOPe 2.07
  
• d5i5jb2 appears in the current release, SCOPe 2.08