Lineage for d5hmba1 (5hmb A:10-133)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. Protein automated matches [190143] (42 species)
    not a true protein
  7. Species Streptomyces sahachiroi [TaxId:285525] [314884] (2 PDB entries)
  8. Domain d5hmba1: 5hmb A:10-133 [314955]
    Other proteins in same PDB: d5hmba2
    automated match to d3s4ka_
    complexed with so4

Details for d5hmba1

PDB Entry: 5hmb (more details), 2.15 Å

PDB Description: crystal structure of s. sahachiroi azig
PDB Compounds: (A:) Azi13

SCOPe Domain Sequences for d5hmba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5hmba1 d.38.1.0 (A:10-133) automated matches {Streptomyces sahachiroi [TaxId: 285525]}
rlgpyvehlglqferidpdravaywsvradllqphgilhggvhcavvesvasaaadrwlg
drgtvvgvsnstdffapatvadgrltstalpvhrgatqqvwsvetvdaagrlvargqvrl
hnlr

SCOPe Domain Coordinates for d5hmba1 are not available.

Timeline for d5hmba1:

Domains from same chain:
(mouse over for more information)
d5hmba2