![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily) 3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest |
![]() | Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) ![]() |
![]() | Family c.68.1.6: glucose-1-phosphate thymidylyltransferase [53464] (4 proteins) automatically mapped to Pfam PF00483 |
![]() | Protein automated matches [191218] (6 species) not a true protein |
![]() | Species Burkholderia vietnamiensis [TaxId:269482] [314952] (3 PDB entries) |
![]() | Domain d5idtb_: 5idt B: [314954] automated match to d1fxob_ complexed with edo, thm |
PDB Entry: 5idt (more details), 2.35 Å
SCOPe Domain Sequences for d5idtb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5idtb_ c.68.1.6 (B:) automated matches {Burkholderia vietnamiensis [TaxId: 269482]} tqrkgiilaggsgtrlhpatlaiskqllpvydkpmiyyplstlmlagmrdvlvistpqdt prfqqllgdgsqwgmnlqyavqpspdglaqafiigeqfignapsalvlgdniyyghdfqp llkaadaqssgatvfayhvhdperygvvqfnaqgqavsieekpkapksnyavtglyfydq qvvdiakavkpsargeleitsvnqaymqqgqlnvqtmgrgyawldtgthdslldasqfia tlenrqglkvacpeeiawrsgwinasqlealvqpltkngygqylmqilk
Timeline for d5idtb_: