Lineage for d5i8ya_ (5i8y A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2814470Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2814471Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 2814748Family b.82.1.6: Acireductone dioxygenase [82191] (2 proteins)
    automatically mapped to Pfam PF03079
  6. 2814749Protein Acireductone dioxygenase [82192] (2 species)
  7. 2814752Species Mouse (Mus musculus) [TaxId:10090] [141601] (6 PDB entries)
    Uniprot Q99JT9 1-179
  8. 2814754Domain d5i8ya_: 5i8y A: [314948]
    automated match to d1vr3a1
    complexed with co, kmt

Details for d5i8ya_

PDB Entry: 5i8y (more details), 1.94 Å

PDB Description: structure of mouse acireductone dioxygenase bound to co2+ and 2-keto- 4-(methylthio)-butyric acid
PDB Compounds: (A:) 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase

SCOPe Domain Sequences for d5i8ya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i8ya_ b.82.1.6 (A:) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]}
mvqawymdestadprkphraqpdrpvsleqlrtlgvlywkldadkyendpelekirkmrn
yswmdiitickdtlpnyeekikmffeehlhldeeiryilegsgyfdvrdkedkwirisme
kgdmitlpagiyhrftldeknyvkamrlfvgepvwtpynrpadhfdarvqymsflegta

SCOPe Domain Coordinates for d5i8ya_:

Click to download the PDB-style file with coordinates for d5i8ya_.
(The format of our PDB-style files is described here.)

Timeline for d5i8ya_: