Class b: All beta proteins [48724] (180 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.1: RmlC-like cupins [51182] (25 families) |
Family b.82.1.6: Acireductone dioxygenase [82191] (2 proteins) automatically mapped to Pfam PF03079 |
Protein Acireductone dioxygenase [82192] (2 species) |
Species Mouse (Mus musculus) [TaxId:10090] [141601] (6 PDB entries) Uniprot Q99JT9 1-179 |
Domain d5i8ya_: 5i8y A: [314948] automated match to d1vr3a1 complexed with co, kmt |
PDB Entry: 5i8y (more details), 1.94 Å
SCOPe Domain Sequences for d5i8ya_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i8ya_ b.82.1.6 (A:) Acireductone dioxygenase {Mouse (Mus musculus) [TaxId: 10090]} mvqawymdestadprkphraqpdrpvsleqlrtlgvlywkldadkyendpelekirkmrn yswmdiitickdtlpnyeekikmffeehlhldeeiryilegsgyfdvrdkedkwirisme kgdmitlpagiyhrftldeknyvkamrlfvgepvwtpynrpadhfdarvqymsflegta
Timeline for d5i8ya_: