Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily) 3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) contains a common phosphate-binding site |
Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein) |
Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species) |
Species Escherichia coli [TaxId:562] [52338] (9 PDB entries) |
Domain d1c3og2: 1c3o G:936-1073 [31494] Other proteins in same PDB: d1c3oa1, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc1, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe1, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3og1, d1c3og3, d1c3og4, d1c3og5, d1c3og6, d1c3oh1, d1c3oh2 |
PDB Entry: 1c3o (more details), 2.1 Å
SCOP Domain Sequences for d1c3og2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c3og2 c.24.1.1 (G:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli} nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln adatekvisvqemhaqik
Timeline for d1c3og2:
View in 3D Domains from other chains: (mouse over for more information) d1c3oa1, d1c3oa2, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc1, d1c3oc2, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe1, d1c3oe2, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3oh1, d1c3oh2 |