| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) ![]() |
| Family d.15.6.0: automated matches [227139] (1 protein) not a true family |
| Protein automated matches [226841] (6 species) not a true protein |
| Species Staphylococcus aureus [TaxId:1280] [225055] (9 PDB entries) |
| Domain d5i4da2: 5i4d A:256-356 [314934] Other proteins in same PDB: d5i4da1, d5i4db1 automated match to d4dxga2 complexed with nag, pg4, pge |
PDB Entry: 5i4d (more details), 1.75 Å
SCOPe Domain Sequences for d5i4da2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5i4da2 d.15.6.0 (A:256-356) automated matches {Staphylococcus aureus [TaxId: 1280]}
kvnhkvelsitkkdnqgmisrdvseymitkeeislkeldfklrkqliekhnlygnmgsgt
ivikmknggkytfelhkklqehrmadvidgtnidnievnik
Timeline for d5i4da2: