SCOPe 2.08: Domain d5i4da2: 5i4d A:256-356

Lineage for d5i4da2 (5i4d A:256-356)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families)

5. Family d.15.6.0: automated matches [227139] (1 protein)
   not a true family

6. Protein automated matches [226841] (6 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [225055] (9 PDB entries)

8. Domain d5i4da2: 5i4d A:256-356 [314934]
   Other proteins in same PDB: d5i4da1, d5i4db1
   automated match to d4dxga2
   complexed with nag, pg4, pge

Details for d5i4da2

PDB Entry: 5i4d, 1.75 Å

PDB Description: 1.75 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.

PDB Compounds: (A:) Superantigen-like protein

SCOPe Domain Sequences for d5i4da2:

Sequence; same for both SEQRES and ATOM records:

>d5i4da2 d.15.6.0 (A:256-356) automated matches {Staphylococcus aureus [TaxId: 1280]}
kvnhkvelsitkkdnqgmisrdvseymitkeeislkeldfklrkqliekhnlygnmgsgt
ivikmknggkytfelhkklqehrmadvidgtnidnievnik

Timeline for d5i4da2:

• d5i4da2 first appeared in SCOPe 2.06
  
• d5i4da2 appears in SCOPe 2.07