Lineage for d5i4da2 (5i4d A:256-356)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503593Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 2503814Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 2503815Protein automated matches [226841] (5 species)
    not a true protein
  7. 2503816Species Staphylococcus aureus [TaxId:1280] [225055] (8 PDB entries)
  8. 2503821Domain d5i4da2: 5i4d A:256-356 [314934]
    Other proteins in same PDB: d5i4da1, d5i4db1
    automated match to d4dxga2
    complexed with fuc, gal, nag, ndg, pg4, pge, sia

Details for d5i4da2

PDB Entry: 5i4d (more details), 1.75 Å

PDB Description: 1.75 angstrom crystal structure of superantigen-like protein, exotoxin from staphylococcus aureus, in complex with sialyl-lewisx.
PDB Compounds: (A:) Superantigen-like protein

SCOPe Domain Sequences for d5i4da2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5i4da2 d.15.6.0 (A:256-356) automated matches {Staphylococcus aureus [TaxId: 1280]}
kvnhkvelsitkkdnqgmisrdvseymitkeeislkeldfklrkqliekhnlygnmgsgt
ivikmknggkytfelhkklqehrmadvidgtnidnievnik

SCOPe Domain Coordinates for d5i4da2:

Click to download the PDB-style file with coordinates for d5i4da2.
(The format of our PDB-style files is described here.)

Timeline for d5i4da2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5i4da1