Lineage for d1c3oe2 (1c3o E:936-1073)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 482161Fold c.24: Methylglyoxal synthase-like [52334] (1 superfamily)
    3 layers, a/b/a; parallel beta-sheet of 5 strands, order 32145
  4. 482162Superfamily c.24.1: Methylglyoxal synthase-like [52335] (3 families) (S)
    contains a common phosphate-binding site
  5. 482163Family c.24.1.1: Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52336] (1 protein)
  6. 482164Protein Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain [52337] (1 species)
  7. 482165Species Escherichia coli [TaxId:562] [52338] (10 PDB entries)
  8. 482188Domain d1c3oe2: 1c3o E:936-1073 [31493]
    Other proteins in same PDB: d1c3oa1, d1c3oa3, d1c3oa4, d1c3oa5, d1c3oa6, d1c3ob1, d1c3ob2, d1c3oc1, d1c3oc3, d1c3oc4, d1c3oc5, d1c3oc6, d1c3od1, d1c3od2, d1c3oe1, d1c3oe3, d1c3oe4, d1c3oe5, d1c3oe6, d1c3of1, d1c3of2, d1c3og1, d1c3og3, d1c3og4, d1c3og5, d1c3og6, d1c3oh1, d1c3oh2

Details for d1c3oe2

PDB Entry: 1c3o (more details), 2.1 Å

PDB Description: crystal structure of the carbamoyl phosphate synthetase: small subunit mutant c269s with bound glutamine

SCOP Domain Sequences for d1c3oe2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c3oe2 c.24.1.1 (E:936-1073) Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain {Escherichia coli}
nstmkkhgrallsvregdkervvdlaakllkqgfeldathgtaivlgeaginprlvnkvh
egrphiqdrikngeytyiinttsgrraiedsrvirrsalqykvhydttlnggfatamaln
adatekvisvqemhaqik

SCOP Domain Coordinates for d1c3oe2:

Click to download the PDB-style file with coordinates for d1c3oe2.
(The format of our PDB-style files is described here.)

Timeline for d1c3oe2: